Lineage for d1yifb1 (1yif B:325-533)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664338Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 664339Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 664343Species Bacillus subtilis [TaxId:1423] [141163] (1 PDB entry)
  8. 664345Domain d1yifb1: 1yif B:325-533 [123285]
    Other proteins in same PDB: d1yifa2, d1yifb2, d1yifc2, d1yifd2
    automatically matched to 1YIF A:325-533

Details for d1yifb1

PDB Entry: 1yif (more details), 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium
PDB Compounds: (B:) beta-1,4-xylosidase

SCOP Domain Sequences for d1yifb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yifb1 b.29.1.23 (B:325-533) Beta-D-xylosidase C-terminal domain {Bacillus subtilis [TaxId: 1423]}
atypevdefedstlninfqtlripftnelgsltqapnhlrlfghesltstftqafvarrw
qslhfeaetavefypenfqqaaglvnyyntenwtalqvthdeelgrilelticdnfsfsq
plnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidialeskklsddyirgggff
tgafvgmqcqdtggnhipadfryfrykek

SCOP Domain Coordinates for d1yifb1:

Click to download the PDB-style file with coordinates for d1yifb1.
(The format of our PDB-style files is described here.)

Timeline for d1yifb1: