Lineage for d1yi2o1 (1yi2 O:1-115)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852065Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2852066Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2852067Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2852159Protein Ribosomal protein L18e [52084] (1 species)
  7. 2852160Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 2852169Domain d1yi2o1: 1yi2 O:1-115 [123244]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffkl_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2o1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d1yi2o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d1yi2o1:

Click to download the PDB-style file with coordinates for d1yi2o1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2o1: