Lineage for d1yi2y1 (1yi2 Y:95-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851574Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2851575Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2851576Protein Ribosomal protein L32e [52044] (1 species)
  7. 2851577Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2851586Domain d1yi2y1: 1yi2 Y:95-236 [123254]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2z1
    automatically matched to d1jj2x_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2y1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d1yi2y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d1yi2y1:

Click to download the PDB-style file with coordinates for d1yi2y1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2y1: