SCOPe 2.06: Domain d1yfza1: 1yfz A:3-180

Lineage for d1yfza1 (1yfz A:3-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Xanthine-guanine PRTase (XPRTase) [53273] (2 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [142552] (1 PDB entry)
   Uniprot Q8R7L0 3-180

8. Domain d1yfza1: 1yfz A:3-180 [123098]
   complexed with act, imp, mg

Details for d1yfza1

PDB Entry: 1yfz, 2.2 Å

PDB Description: novel imp binding in feedback inhibition of hypoxanthine-guanine phosphoribosyltransferase from thermoanaerobacter tengcongensis

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1yfza1:

Sequence; same for both SEQRES and ATOM records:

>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]}
spmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidlpl
sidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgrkp
rslkictildkperreadvkvdycgfkipdkfvvgygldyaekyrnlpfigvlkpely

Timeline for d1yfza1:

• d1yfza1 first appeared in SCOP 1.73
  
• d1yfza1 appears in SCOPe 2.05
  
• d1yfza1 appears in SCOPe 2.07
  
• d1yfza1 appears in the current release, SCOPe 2.08