SCOPe 2.08: Domain d1yfxa_: 1yfx A:

Lineage for d1yfxa_ (1yfx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins)
   Pfam PF06052; 3-HAO

6. Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species)

7. Species Ralstonia metallidurans [TaxId:119219] [141620] (11 PDB entries)
   Uniprot Q1LCS4 1-174

8. Domain d1yfxa_: 1yfx A: [123096]
   automated match to d1yfua1
   complexed with 4aa, fe, no, trs

Details for d1yfxa_

PDB Entry: 1yfx, 2 Å

PDB Description: Crystal structure of 3-hydroxyanthranilate-3,4-dioxygenase from Ralstonia metallidurans complexed with 4-chloro-3-hydroxyanthranilic acid and NO

PDB Compounds: (A:) 3-hydroxyanthranilate-3,4-dioxygenase

SCOPe Domain Sequences for d1yfxa_:

Sequence; same for both SEQRES and ATOM records:

>d1yfxa_ b.82.1.20 (A:) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]}
mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy
qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg
fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa

Timeline for d1yfxa_:

• d1yfxa_ first appeared in SCOP 1.73, called d1yfxa1
  
• d1yfxa_ appears in SCOPe 2.07