Lineage for d1yfsa2 (1yfs A:1-236)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1663709Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1663710Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)
  7. 1663711Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)
  8. 1663712Domain d1yfsa2: 1yfs A:1-236 [123089]
    Other proteins in same PDB: d1yfsa1, d1yfsb1
    automated match to d1riqa2
    protein/RNA complex; complexed with ala

Details for d1yfsa2

PDB Entry: 1yfs (more details), 2.08 Å

PDB Description: The crystal structure of alanyl-tRNA synthetase in complex with L-alanine
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yfsa2 d.104.1.1 (A:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

SCOPe Domain Coordinates for d1yfsa2:

Click to download the PDB-style file with coordinates for d1yfsa2.
(The format of our PDB-style files is described here.)

Timeline for d1yfsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yfsa1