SCOPe 2.04: Domain d1yfha2: 1yfh A:5-91

Lineage for d1yfha2 (1yfh A:5-91)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.7: Methylated DNA-protein cysteine methyltransferase domain [53155] (2 families)

5. Family c.55.7.1: Methylated DNA-protein cysteine methyltransferase domain [53156] (2 proteins)

6. Protein O6-alkylguanine-DNA alkyltransferase [53159] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53160] (7 PDB entries)
   Uniprot P16455 6-176

8. Domain d1yfha2: 1yfh A:5-91 [123063]
   Other proteins in same PDB: d1yfha1, d1yfhb1, d1yfhc1
   automatically matched to d1eh6a2
   protein/DNA complex; complexed with zn

Details for d1yfha2

PDB Entry: 1yfh, 3.01 Å

PDB Description: wt Human O6-Alkylguanine-DNA Alkyltransferase Bound To DNA Containing an Alkylated Cytosine

PDB Compounds: (A:) methylated-DNA--protein-cysteine methyltransferase

SCOPe Domain Sequences for d1yfha2:

Sequence, based on SEQRES records:

>d1yfha2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgkgtsaadavevpapaavlggpeplmqcta
wlnayfhqpeaieefpvpalhhpvfqq

Sequence, based on observed residues (ATOM records):

>d1yfha2 c.55.7.1 (A:5-91) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens) [TaxId: 9606]}
cemkrttldsplgklelsgceqglheikllgvpapaavlggpeplmqctawlnayfhqpe
aieefpvpalhhpvfqq

Timeline for d1yfha2:

• d1yfha2 first appeared in SCOP 1.73
  
• d1yfha2 appears in SCOPe 2.03
  
• d1yfha2 appears in SCOPe 2.05
  
• d1yfha2 appears in the current release, SCOPe 2.08