Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Leishmania major [TaxId:5664] [143049] (1 PDB entry) Uniprot Q4Q5L3 9-166 Ubiquitin carrier protein 4, putative |
Domain d1yf9a1: 1yf9 A:13-170 [123054] Other proteins in same PDB: d1yf9b_, d1yf9c_ complexed with cl |
PDB Entry: 1yf9 (more details), 2 Å
SCOPe Domain Sequences for d1yf9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa ahllhadrvgfdallrehvsthatpqkalesipeayrp
Timeline for d1yf9a1: