SCOPe 2.06: Domain d1yf2b2: 1yf2 B:221-425

Lineage for d1yf2b2 (1yf2 B:221-425)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
   Pfam PF01420

6. Protein Bipartite methylase S protein MJ0130 [143982] (1 species)
   duplication: comprises two repeats of this domain, separated by a coiled coil made by additional long helices at the C-end of each repeat

7. Species Methanocaldococcus jannaschii [TaxId:2190] [143983] (1 PDB entry)
   Uniprot Q57594 1-220! Uniprot Q57594 221-425

8. Domain d1yf2b2: 1yf2 B:221-425 [123045]
   automated match to d1yf2a2

Details for d1yf2b2

PDB Entry: 1yf2, 2.4 Å

PDB Description: Three-dimensional structure of DNA sequence specificity (S) subunit of a type I restriction-modification enzyme and its functional implications

PDB Compounds: (B:) Type I restriction-modification enzyme, S subunit

SCOPe Domain Sequences for d1yf2b2:

Sequence; same for both SEQRES and ATOM records:

>d1yf2b2 d.287.1.2 (B:221-425) Bipartite methylase S protein MJ0130 {Methanocaldococcus jannaschii [TaxId: 2190]}
igeipedwevfeikdifevktgttpstkkseywengeinwitpldlsrlnekiyigsser
kvtkialekcnlnlipkgsiiistrapvgyvavltvestfnqgckglfqknndsvntefy
ayylkfkknllenlsggstfkelsksmlenfkiplppleeqkqiakilssvdksielkkq
kkeklqrmkkkimellltgkvrvkt

Timeline for d1yf2b2:

• d1yf2b2 first appeared in SCOP 1.73
  
• d1yf2b2 appears in SCOPe 2.05
  
• d1yf2b2 appears in SCOPe 2.07
  
• d1yf2b2 appears in the current release, SCOPe 2.08