SCOPe 2.02: Domain d1ycha2: 1ych A:2-250

Lineage for d1ycha2 (1ych A:2-250)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (3 proteins)

6. Protein Nitric oxide reductase N-terminal domain [143914] (1 species)

7. Species Moorella thermoacetica [TaxId:1525] [143915] (3 PDB entries)
   Uniprot Q9FDN7 2-250

8. Domain d1ycha2: 1ych A:2-250 [122958]
   Other proteins in same PDB: d1ycha1, d1ychb1, d1ychc1, d1ychd1
   automatically matched to 1YCF A:2-250
   complexed with feo, fmn, zn

Details for d1ycha2

PDB Entry: 1ych, 2.8 Å

PDB Description: x-ray crystal structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase

PDB Compounds: (A:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycha2:

Sequence; same for both SEQRES and ATOM records:

>d1ycha2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]}
sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
ayarwaegq

Timeline for d1ycha2:

• d1ycha2 first appeared in SCOP 1.73
  
• d1ycha2 appears in SCOPe 2.01
  
• d1ycha2 appears in SCOPe 2.03
  
• d1ycha2 appears in the current release, SCOPe 2.08