Lineage for d1ycgd1 (1ycg D:251-399)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2464624Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2464714Protein Nitric oxide reductase C-terminal domain [142047] (2 species)
  7. 2464718Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries)
    Uniprot Q9FDN7 251-399
  8. 2464722Domain d1ycgd1: 1ycg D:251-399 [122955]
    Other proteins in same PDB: d1ycga2, d1ycgb2, d1ycgc2, d1ycgd2
    automated match to d1ycfa1
    complexed with edo, feo, fmn, zn

Details for d1ycgd1

PDB Entry: 1ycg (more details), 2.8 Å

PDB Description: x-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
PDB Compounds: (D:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycgd1 c.23.5.1 (D:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

SCOPe Domain Coordinates for d1ycgd1:

Click to download the PDB-style file with coordinates for d1ycgd1.
(The format of our PDB-style files is described here.)

Timeline for d1ycgd1: