Lineage for d1ycgb1 (1ycg B:251-399)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838448Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1838538Protein Nitric oxide reductase C-terminal domain [142047] (2 species)
  7. 1838542Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries)
    Uniprot Q9FDN7 251-399
  8. 1838544Domain d1ycgb1: 1ycg B:251-399 [122951]
    Other proteins in same PDB: d1ycga2, d1ycgb2, d1ycgc2, d1ycgd2
    automated match to d1ycfa1
    complexed with edo, feo, fmn, zn

Details for d1ycgb1

PDB Entry: 1ycg (more details), 2.8 Å

PDB Description: x-ray structures of moorella thermoacetica fpra. novel diiron site structure and mechanistic insights into a scavenging nitric oxide reductase
PDB Compounds: (B:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycgb1 c.23.5.1 (B:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

SCOPe Domain Coordinates for d1ycgb1:

Click to download the PDB-style file with coordinates for d1ycgb1.
(The format of our PDB-style files is described here.)

Timeline for d1ycgb1: