![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Nitric oxide reductase C-terminal domain [142047] (2 species) |
![]() | Species Moorella thermoacetica [TaxId:1525] [142048] (3 PDB entries) Uniprot Q9FDN7 251-399 |
![]() | Domain d1ycgb1: 1ycg B:251-399 [122951] Other proteins in same PDB: d1ycga2, d1ycgb2, d1ycgc2, d1ycgd2 automated match to d1ycfa1 complexed with edo, feo, fmn, zn |
PDB Entry: 1ycg (more details), 2.8 Å
SCOPe Domain Sequences for d1ycgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycgb1 c.23.5.1 (B:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep gptvqwvprgedlqrcyelgrkiaariad
Timeline for d1ycgb1: