Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins) |
Protein Cucumovirus coat protein [88640] (4 species) |
Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (3 PDB entries) |
Domain d1yc6q_: 1yc6 Q: [122931] |
PDB Entry: 1yc6 (more details), 2.9 Å
SCOPe Domain Sequences for d1yc6q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yc6q_ b.121.4.5 (Q:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]} aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy lyaseavpakavvvhlevehvrptfddfftpvyr
Timeline for d1yc6q_:
View in 3D Domains from other chains: (mouse over for more information) d1yc61_, d1yc62_, d1yc63_, d1yc64_, d1yc6a_, d1yc6b_, d1yc6c_, d1yc6d_, d1yc6e_, d1yc6f_, d1yc6g_, d1yc6h_, d1yc6i_, d1yc6j_, d1yc6k_, d1yc6l_, d1yc6m_, d1yc6n_, d1yc6o_, d1yc6p_, d1yc6r_, d1yc6s_, d1yc6t_, d1yc6u_, d1yc6v_, d1yc6w_, d1yc6x_, d1yc6y_, d1yc6z_ |