Lineage for d1ybha2 (1ybh A:86-280)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986456Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 986457Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 986458Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 986459Protein Acetohydroxyacid synthase catalytic subunit [88733] (2 species)
  7. 986475Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142204] (6 PDB entries)
    Uniprot P17597 86-280
  8. 986476Domain d1ybha2: 1ybh A:86-280 [122892]
    Other proteins in same PDB: d1ybha1, d1ybha3
    complexed with cie, fad, mg, nhe, p22

Details for d1ybha2

PDB Entry: 1ybh (more details), 2.5 Å

PDB Description: Crystal structure of Arabidopsis thaliana Acetohydroxyacid synthase In Complex With A Sulfonylurea Herbicide Chlorimuron Ethyl
PDB Compounds: (A:) Acetolactate synthase, chloroplast

SCOPe Domain Sequences for d1ybha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybha2 c.36.1.5 (A:86-280) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]}
tfisrfapdqprkgadilvealerqgvetvfaypggasmeihqaltrsssirnvlprheq
ggvfaaegyarssgkpgiciatsgpgatnlvsgladalldsvplvaitgqvprrmigtda
fqetpivevtrsitkhnylvmdvedipriieeafflatsgrpgpvlvdvpkdiqqqlaip
nweqamrlpgymsrm

SCOPe Domain Coordinates for d1ybha2:

Click to download the PDB-style file with coordinates for d1ybha2.
(The format of our PDB-style files is described here.)

Timeline for d1ybha2: