Lineage for d1ybaa3 (1yba A:327-410)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560919Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2560920Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 2560921Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 2560922Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 2560927Domain d1ybaa3: 1yba A:327-410 [122874]
    Other proteins in same PDB: d1ybaa1, d1ybaa2, d1ybab1, d1ybab2, d1ybac1, d1ybac2, d1ybad1, d1ybad2
    automatically matched to d1psda3
    complexed with akg, nad, po4, unl

Details for d1ybaa3

PDB Entry: 1yba (more details), 2.24 Å

PDB Description: The active form of phosphoglycerate dehydrogenase
PDB Compounds: (A:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d1ybaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ybaa3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhggrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOPe Domain Coordinates for d1ybaa3:

Click to download the PDB-style file with coordinates for d1ybaa3.
(The format of our PDB-style files is described here.)

Timeline for d1ybaa3: