Lineage for d1y9wb_ (1y9w B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427091Protein Probable acetyltransferase BC2806 [143650] (1 species)
  7. 1427092Species Bacillus cereus [TaxId:1396] [143651] (1 PDB entry)
    Uniprot Q81CG1 1-140
  8. 1427094Domain d1y9wb_: 1y9w B: [122784]
    automated match to d1y9wa1

Details for d1y9wb_

PDB Entry: 1y9w (more details), 1.9 Å

PDB Description: Structural Genomics, 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (B:) Acetyltransferase

SCOPe Domain Sequences for d1y9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9wb_ d.108.1.1 (B:) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}
mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy
fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre
ygvvedhpkghsqhffekrl

SCOPe Domain Coordinates for d1y9wb_:

Click to download the PDB-style file with coordinates for d1y9wb_.
(The format of our PDB-style files is described here.)

Timeline for d1y9wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y9wa1