| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species) component of the pyruvate dehydrogenase complex |
| Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries) |
| Domain d1y8nb_: 1y8n B: [122758] Other proteins in same PDB: d1y8na1, d1y8na2 automated match to d1fyca_ complexed with k, red |
PDB Entry: 1y8n (more details), 2.6 Å
SCOPe Domain Sequences for d1y8nb_:
Sequence, based on SEQRES records: (download)
>d1y8nb_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadyrptevtdlk
>d1y8nb_ b.84.1.1 (B:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadytdlk
Timeline for d1y8nb_: