Lineage for d1y8nb1 (1y8n B:128-229)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678222Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 678223Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 678224Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 678236Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 678245Species Human (Homo sapiens) [TaxId:9606] [51242] (4 PDB entries)
  8. 678247Domain d1y8nb1: 1y8n B:128-229 [122758]
    automatically matched to d1fyc__
    complexed with k, lpa

Details for d1y8nb1

PDB Entry: 1y8n (more details), 2.6 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (B:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOP Domain Sequences for d1y8nb1:

Sequence, based on SEQRES records: (download)

>d1y8nb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadyrptevtdlk

Sequence, based on observed residues (ATOM records): (download)

>d1y8nb1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
sypphmqvllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegyla
kilvpegtrdvplgtplciivekeadisafadytdlk

SCOP Domain Coordinates for d1y8nb1:

Click to download the PDB-style file with coordinates for d1y8nb1.
(The format of our PDB-style files is described here.)

Timeline for d1y8nb1: