Lineage for d1y8ha1 (1y8h A:1-141)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254115Species Horse (Equus caballus) [TaxId:9796] [46488] (16 PDB entries)
  8. 1254130Domain d1y8ha1: 1y8h A:1-141 [122744]
    Other proteins in same PDB: d1y8hb1, d1y8hd1
    automatically matched to d1g0ba_
    complexed with hem

Details for d1y8ha1

PDB Entry: 1y8h (more details), 3.1 Å

PDB Description: horse methemoglobin low salt, ph 7.0
PDB Compounds: (A:) Hemoglobin alpha chains

SCOPe Domain Sequences for d1y8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8ha1 a.1.1.2 (A:1-141) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

SCOPe Domain Coordinates for d1y8ha1:

Click to download the PDB-style file with coordinates for d1y8ha1.
(The format of our PDB-style files is described here.)

Timeline for d1y8ha1: