SCOPe 2.03: Domain d1y7yb_: 1y7y B:

Lineage for d1y7yb_ (1y7y B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein automated matches [190827] (2 species)
   not a true protein

7. Species Aeromonas hydrophila [TaxId:644] [188128] (1 PDB entry)

8. Domain d1y7yb_: 1y7y B: [122730]
   Other proteins in same PDB: d1y7ya1
   automated match to d1y7ya1

Details for d1y7yb_

PDB Entry: 1y7y, 1.69 Å

PDB Description: High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila

PDB Compounds: (B:) C.AhdI

SCOPe Domain Sequences for d1y7yb_:

Sequence; same for both SEQRES and ATOM records:

>d1y7yb_ a.35.1.3 (B:) automated matches {Aeromonas hydrophila [TaxId: 644]}
yadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklataldi
eprelf

Timeline for d1y7yb_:

• d1y7yb_ first appeared in SCOP 1.73, called d1y7yb1
  
• d1y7yb_ appears in SCOPe 2.02
  
• d1y7yb_ appears in SCOPe 2.04
  
• d1y7yb_ appears in the current release, SCOPe 2.08