Lineage for d1y7yb_ (1y7y B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709500Protein automated matches [190827] (2 species)
    not a true protein
  7. 2709501Species Aeromonas hydrophila [TaxId:644] [188128] (1 PDB entry)
  8. 2709502Domain d1y7yb_: 1y7y B: [122730]
    Other proteins in same PDB: d1y7ya1
    automated match to d1y7ya1

Details for d1y7yb_

PDB Entry: 1y7y (more details), 1.69 Å

PDB Description: High-resolution crystal structure of the restriction-modification controller protein C.AhdI from Aeromonas hydrophila
PDB Compounds: (B:) C.AhdI

SCOPe Domain Sequences for d1y7yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7yb_ a.35.1.3 (B:) automated matches {Aeromonas hydrophila [TaxId: 644]}
yadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklataldi
eprelf

SCOPe Domain Coordinates for d1y7yb_:

Click to download the PDB-style file with coordinates for d1y7yb_.
(The format of our PDB-style files is described here.)

Timeline for d1y7yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1y7ya1