Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
Protein automated matches [190827] (2 species) not a true protein |
Species Aeromonas hydrophila [TaxId:644] [188128] (1 PDB entry) |
Domain d1y7yb_: 1y7y B: [122730] Other proteins in same PDB: d1y7ya1 automated match to d1y7ya1 |
PDB Entry: 1y7y (more details), 1.69 Å
SCOPe Domain Sequences for d1y7yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7yb_ a.35.1.3 (B:) automated matches {Aeromonas hydrophila [TaxId: 644]} yadlvkfgqrlrelrtakglsqetlaflsgldrsyvggvergqrnvslvnilklataldi eprelf
Timeline for d1y7yb_: