Lineage for d1y7ra1 (1y7r A:1-133)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664450Protein Hypothetical protein SA2161 [143674] (1 species)
  7. 1664451Species Staphylococcus aureus [TaxId:1280] [143675] (1 PDB entry)
    Uniprot Q7A3W2 1-133
  8. 1664452Domain d1y7ra1: 1y7r A:1-133 [122716]
    complexed with po4

Details for d1y7ra1

PDB Entry: 1y7r (more details), 1.7 Å

PDB Description: 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase
PDB Compounds: (A:) hypothetical protein SA2161

SCOPe Domain Sequences for d1y7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}
mvkvtydiptcedycalrinagmspktreaaekglpnalftvtlydkdrligmgrvigdg
gtvfqivdiavlksyqgqaygslimehimkyiknvsvesvyvsliadypadklyvkfgfm
ptepdsggmyiky

SCOPe Domain Coordinates for d1y7ra1:

Click to download the PDB-style file with coordinates for d1y7ra1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ra1: