Lineage for d1y7og1 (1y7o G:2-193)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980709Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 980815Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141998] (1 PDB entry)
    Uniprot P63788 2-193
  8. 980822Domain d1y7og1: 1y7o G:2-193 [122707]
    automatically matched to 1Y7O A:2-193
    complexed with ca

Details for d1y7og1

PDB Entry: 1y7o (more details), 2.51 Å

PDB Description: the structure of streptococcus pneumoniae a153p clpp
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d1y7og1:

Sequence, based on SEQRES records: (download)

>d1y7og1 c.14.1.1 (G:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyly
vntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymih
qpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqetl
eygfideimann

Sequence, based on observed residues (ATOM records): (download)

>d1y7og1 c.14.1.1 (G:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
ipvvieqtersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvnt
pggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpm
iapehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimann

SCOPe Domain Coordinates for d1y7og1:

Click to download the PDB-style file with coordinates for d1y7og1.
(The format of our PDB-style files is described here.)

Timeline for d1y7og1: