![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) |
![]() | Protein Clp protease, ClpP subunit [52098] (8 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141998] (1 PDB entry) Uniprot P63788 2-193 |
![]() | Domain d1y7og1: 1y7o G:2-193 [122707] automatically matched to 1Y7O A:2-193 complexed with ca |
PDB Entry: 1y7o (more details), 2.51 Å
SCOPe Domain Sequences for d1y7og1:
Sequence, based on SEQRES records: (download)
>d1y7og1 c.14.1.1 (G:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ipvvieqtsrgersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiyly vntpggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymih qpmggtgggtqqtdmaiapehllktrntlekilaensgqsmekvhadaerdnwmsaqetl eygfideimann
>d1y7og1 c.14.1.1 (G:2-193) Clp protease, ClpP subunit {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ipvvieqtersydiysrllkdriimltgpvednmansviaqllfldaqdstkdiylyvnt pggsvsaglaivdtmnfikadvqtivmgmaasmgtviassgakgkrfmlpnaeymihqpm iapehllktrntlekilaensgqsmekvhadaerdnwmsaqetleygfideimann
Timeline for d1y7og1: