SCOPe 2.02: Domain d1y64a1: 1y64 A:7-146

Lineage for d1y64a1 (1y64 A:7-146)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d1y64a1: 1y64 A:7-146 [122657]
   Other proteins in same PDB: d1y64b1
   automatically matched to d1hlua1
   complexed with atp, ca

Details for d1y64a1

PDB Entry: 1y64, 3.05 Å

PDB Description: Bni1p Formin Homology 2 Domain complexed with ATP-actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1y64a1:

Sequence, based on SEQRES records:

>d1y64a1 c.55.1.1 (A:7-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
alvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgilt
lkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfet
fnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1y64a1 c.55.1.1 (A:7-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
alvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgiitn
wddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqa
vlslyasg

Timeline for d1y64a1:

• d1y64a1 first appeared in SCOP 1.73
  
• d1y64a1 appears in SCOPe 2.01
  
• d1y64a1 appears in SCOPe 2.03
  
• d1y64a1 appears in the current release, SCOPe 2.08