SCOPe 2.08: Domain d1y2gb_: 1y2g B:

Lineage for d1y2gb_ (1y2g B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold
   automatically mapped to Pfam PF04354

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (2 proteins)

6. Protein automated matches [190138] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186864] (2 PDB entries)

8. Domain d1y2gb_: 1y2g B: [122566]
   automated match to d1f7wa_
   complexed with cl3

Details for d1y2gb_

PDB Entry: 1y2g, 1.9 Å

PDB Description: Crystal STructure of ZipA in complex with an inhibitor

PDB Compounds: (B:) cell division protein zipa

SCOPe Domain Sequences for d1y2gb_:

Sequence; same for both SEQRES and ATOM records:

>d1y2gb_ d.129.4.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
krkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanm
vkpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmm
tpqklreyqdiirevkdana

Timeline for d1y2gb_:

• d1y2gb_ first appeared in SCOP 1.73, called d1y2gb1
  
• d1y2gb_ appears in SCOPe 2.07