SCOP 1.73: Domain d1y2gb1: 1y2g B:6-142

Lineage for d1y2gb1 (1y2g B:6-142)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.4: Cell-division protein ZipA, C-terminal domain [64383] (1 family)
   contains a single copy of this fold

5. Family d.129.4.1: Cell-division protein ZipA, C-terminal domain [64384] (1 protein)

6. Protein Cell-division protein ZipA, C-terminal domain [64385] (1 species)

7. Species Escherichia coli [TaxId:562] [64386] (8 PDB entries)

8. Domain d1y2gb1: 1y2g B:6-142 [122566]
   automatically matched to d1f7wa_
   complexed with cl3

Details for d1y2gb1

PDB Entry: 1y2g, 1.9 Å

PDB Description: Crystal STructure of ZipA in complex with an inhibitor

PDB Compounds: (B:) cell division protein zipa

SCOP Domain Sequences for d1y2gb1:

Sequence; same for both SEQRES and ATOM records:

>d1y2gb1 d.129.4.1 (B:6-142) Cell-division protein ZipA, C-terminal domain {Escherichia coli [TaxId: 562]}
rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
kpgtfdpemkdfttpgvtifmqvpsygdelqnfklmlqsaqhiadevggvvlddqrrmmt
pqklreyqdiirevkda

Timeline for d1y2gb1:

• d1y2gb1 is new in SCOP 1.73
  
• d1y2gb1 appears in SCOP 1.75
  
• d1y2gb1 appears in the current release, SCOPe 2.08, called d1y2gb_