|  | Class a: All alpha proteins [46456] (285 folds) | 
|  | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles | 
|  | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)  | 
|  | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains | 
|  | Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries) Uniprot Q08499 388-713 | 
|  | Domain d1y2db_: 1y2d B: [122561] automated match to d1oyna_ complexed with 4de, b3p, edo, mg, zn | 
PDB Entry: 1y2d (more details), 1.7 Å
SCOPe Domain Sequences for d1y2db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2db_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip
Timeline for d1y2db_: