Class a: All alpha proteins [46456] (258 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) |
Family a.211.1.2: PDEase [48548] (6 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries) |
Domain d1y2ca1: 1y2c A:86-411 [122558] automatically matched to d1oyna_ complexed with 3de, edo, mg, zn |
PDB Entry: 1y2c (more details), 1.67 Å
SCOP Domain Sequences for d1y2ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2ca1 a.211.1.2 (A:86-411) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa dlvhpdaqdildtlednrewyqstip
Timeline for d1y2ca1: