Lineage for d1y25a1 (1y25 A:3-165)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992926Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 993112Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 993129Species Mycobacterium tuberculosis [TaxId:1773] [117600] (2 PDB entries)
    Uniprot P66952
  8. 993131Domain d1y25a1: 1y25 A:3-165 [122554]
    complexed with act

Details for d1y25a1

PDB Entry: 1y25 (more details), 2.1 Å

PDB Description: structure of mycobacterial thiol peroxidase tpx
PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d1y25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y25a1 c.47.1.10 (A:3-165) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}
qitlrgnaintvgelpavgspapaftltggdlgvissdqfrgksvllnifpsvdtpvsat
svrtfderaaasgatvlcvskdlpfaqkrfcgaegtenvmpasafrdsfgedygvtiadg
pmagllaraivvigadgnvaytelvpeiaqepnyeaalaalga

SCOPe Domain Coordinates for d1y25a1:

Click to download the PDB-style file with coordinates for d1y25a1.
(The format of our PDB-style files is described here.)

Timeline for d1y25a1: