SCOP 1.73: Domain d1xzna1: 1xzn A:1-179

Lineage for d1xzna1 (1xzn A:1-179)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Pyrimidine operon regulator PyrR [109612] (4 species)
   bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities

7. Species Bacillus caldolyticus [TaxId:1394] [110659] (3 PDB entries)

8. Domain d1xzna1: 1xzn A:1-179 [122472]
   automatically matched to d1nona_
   complexed with mg, so4

Details for d1xzna1

PDB Entry: 1xzn, 2.27 Å

PDB Description: pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form

PDB Compounds: (A:) PyrR bifunctional protein

SCOP Domain Sequences for d1xzna1:

Sequence, based on SEQRES records:

>d1xzna1 c.61.1.1 (A:1-179) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records):

>d1xzna1 c.61.1.1 (A:1-179) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrg
hrelpiradfvgknvptsrselivvelsevdgidqvsihek

Timeline for d1xzna1:

• d1xzna1 is new in SCOP 1.73
  
• d1xzna1 appears in SCOP 1.75
  
• d1xzna1 appears in the current release, SCOPe 2.08, called d1xzna_