Lineage for d1xznb1 (1xzn B:1-179)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703952Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 703953Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 703954Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)
  6. 704135Protein Pyrimidine operon regulator PyrR [109612] (4 species)
    bifunctional protein; contains the uracil PRTase and Pyr RNA-binding activities
  7. 704136Species Bacillus caldolyticus [TaxId:1394] [110659] (3 PDB entries)
  8. 704142Domain d1xznb1: 1xzn B:1-179 [122473]
    automatically matched to d1nona_
    complexed with mg, so4

Details for d1xznb1

PDB Entry: 1xzn (more details), 2.27 Å

PDB Description: pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, sulfate-bound form
PDB Compounds: (B:) PyrR bifunctional protein

SCOP Domain Sequences for d1xznb1:

Sequence, based on SEQRES records: (download)

>d1xznb1 c.61.1.1 (B:1-179) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyrddltvktddheplvkgtnvpfpvternvilvddvlftgrtvraamdav
mdlgrpariqlavlvdrghrelpiradfvgknvptsrselivvelsevdgidqvsihek

Sequence, based on observed residues (ATOM records): (download)

>d1xznb1 c.61.1.1 (B:1-179) Pyrimidine operon regulator PyrR {Bacillus caldolyticus [TaxId: 1394]}
mqkavvmdeqairraltriaheiiernkgidgcvlvgiktrgiylarrlaerieqiegas
vpvgelditlyvpfpvternvilvddvlftgrtvraamdavmdlgrpariqlavlvdrgh
relpiradfvgknvptsrselivvelsevdgidqvsihek

SCOP Domain Coordinates for d1xznb1:

Click to download the PDB-style file with coordinates for d1xznb1.
(The format of our PDB-style files is described here.)

Timeline for d1xznb1: