Lineage for d1xxxd_ (1xxx D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1147696Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1147825Protein Dihydrodipicolinate synthase [51574] (12 species)
  7. 1147891Species Mycobacterium tuberculosis [TaxId:1773] [141831] (1 PDB entry)
    Uniprot P63945 5-300
  8. 1147895Domain d1xxxd_: 1xxx D: [122436]
    automated match to d1o5ka_
    complexed with cl, dtt, mg

Details for d1xxxd_

PDB Entry: 1xxx (more details), 2.28 Å

PDB Description: Crystal structure of Dihydrodipicolinate Synthase (DapA, Rv2753c) from Mycobacterium tuberculosis
PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d1xxxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxxd_ c.1.10.1 (D:) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}
fdvaarlgtlltamvtpfsgdgsldtataarlanhlvdqgcdglvvsgttgesptttdge
kiellravleavgdrarviagagtydtahsirlakacaaegahgllvvtpyyskppqrgl
qahftavadatelpmllydipgrsavpiepdtiralashpnivgvkdakadlhsgaqima
dtglayysgddalnlpwlamgatgfisviahlaagqlrellsafgsgdiatarkiniava
plcnamsrlggvtlskaglrlqgidvgdprlpqvaatpeqidalaadmraasvlr

SCOPe Domain Coordinates for d1xxxd_:

Click to download the PDB-style file with coordinates for d1xxxd_.
(The format of our PDB-style files is described here.)

Timeline for d1xxxd_: