Lineage for d1xxvb1 (1xxv B:187-468)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167639Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1167640Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1167712Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1167717Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (1 species)
  7. 1167718Species Yersinia enterocolitica [TaxId:630] [52812] (11 PDB entries)
  8. 1167730Domain d1xxvb1: 1xxv B:187-468 [122430]
    automatically matched to d1pa9a_

Details for d1xxvb1

PDB Entry: 1xxv (more details), 2.5 Å

PDB Description: Yersinia YopH (residues 163-468) binds phosphonodifluoromethyl-Phe containing hexapeptide at two sites
PDB Compounds: (B:) protein-tyrosine phosphatase yoph

SCOPe Domain Sequences for d1xxvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxvb1 c.45.1.2 (B:187-468) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d1xxvb1:

Click to download the PDB-style file with coordinates for d1xxvb1.
(The format of our PDB-style files is described here.)

Timeline for d1xxvb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xxva1