Lineage for d1xxna_ (1xxn A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534192Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1534237Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1534293Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)
  8. 1534299Domain d1xxna_: 1xxn A: [122422]
    automated match to d2dcya1
    complexed with srt

Details for d1xxna_

PDB Entry: 1xxn (more details), 1.7 Å

PDB Description: crystal structure of a mesophilic xylanase a from bacillus subtilis 1a1
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1xxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxna_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d1xxna_:

Click to download the PDB-style file with coordinates for d1xxna_.
(The format of our PDB-style files is described here.)

Timeline for d1xxna_: