Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (18 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries) |
Domain d1xxna_: 1xxn A: [122422] automated match to d2dcya1 complexed with srt |
PDB Entry: 1xxn (more details), 1.7 Å
SCOPe Domain Sequences for d1xxna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xxna_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis [TaxId: 1423]} astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d1xxna_: