![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein) |
![]() | Protein S-adenosylhomocystein hydrolase [52301] (3 species) contains additional secondary structures disguising the superfamily fold |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries) |
![]() | Domain d1xwfc2: 1xwf C:2-189,C:353-431 [122397] Other proteins in same PDB: d1xwfa1, d1xwfb1, d1xwfc1, d1xwfd1 automatically matched to d1d4fa2 complexed with adn, nad |
PDB Entry: 1xwf (more details), 2.8 Å
SCOPe Domain Sequences for d1xwfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwfc2 c.23.12.3 (C:2-189,C:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]} dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd svtnskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv kltkltekqaqylgmpingpfkpdhyry
Timeline for d1xwfc2: