Lineage for d1xwfd2 (1xwf D:2-189,D:353-431)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857771Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2857772Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2857779Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)
  8. 2857811Domain d1xwfd2: 1xwf D:2-189,D:353-431 [122399]
    Other proteins in same PDB: d1xwfa1, d1xwfb1, d1xwfc1, d1xwfd1
    automatically matched to d1d4fa2
    complexed with adn, nad

Details for d1xwfd2

PDB Entry: 1xwf (more details), 2.8 Å

PDB Description: k185n mutated s-adenosylhomocysteine hydrolase
PDB Compounds: (D:) Adenosylhomocysteinase

SCOPe Domain Sequences for d1xwfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwfd2 c.23.12.3 (D:2-189,D:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtnskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOPe Domain Coordinates for d1xwfd2:

Click to download the PDB-style file with coordinates for d1xwfd2.
(The format of our PDB-style files is described here.)

Timeline for d1xwfd2: