Lineage for d1xvcf_ (1xvc F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083160Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1083191Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 1083192Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1083193Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1083194Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 1083212Domain d1xvcf_: 1xvc F: [122355]
    Other proteins in same PDB: d1xvca1, d1xvcb1, d1xvcc_, d1xvcd_
    automated match to d1fyzf_
    complexed with 5br, bmm, br, fe, fmt

Details for d1xvcf_

PDB Entry: 1xvc (more details), 2 Å

PDB Description: soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure
PDB Compounds: (F:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d1xvcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xvcf_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
lgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp

SCOPe Domain Coordinates for d1xvcf_:

Click to download the PDB-style file with coordinates for d1xvcf_.
(The format of our PDB-style files is described here.)

Timeline for d1xvcf_: