SCOPe 2.08: Domain d1xuob_: 1xuo B:

Lineage for d1xuob_ (1xuo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
   Uniprot P20701 153-334

8. Domain d1xuob_: 1xuo B: [122337]
   automated match to d1dgqa_
   complexed with la1, mg

Details for d1xuob_

PDB Entry: 1xuo, 1.8 Å

PDB Description: X-ray structure of LFA-1 I-domain bound to a 1,4-diazepane-2,5-dione inhibitor at 1.8A resolution

PDB Compounds: (B:) Integrin alpha-L

SCOPe Domain Sequences for d1xuob_:

Sequence; same for both SEQRES and ATOM records:

>d1xuob_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftel

Timeline for d1xuob_:

• d1xuob_ first appeared in SCOP 1.73, called d1xuob1
  
• d1xuob_ appears in SCOPe 2.07