Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins) |
Protein automated matches [254454] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries) |
Domain d1xmla1: 1xml A:146-336 [122166] Other proteins in same PDB: d1xmla2, d1xmlb2 automated match to d1st0a1 complexed with po4 |
PDB Entry: 1xml (more details), 2 Å
SCOPe Domain Sequences for d1xmla1:
Sequence, based on SEQRES records: (download)
>d1xmla1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd mkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtmtfalradd pllkllqeaqq
>d1xmla1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd mkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv ylhylpsyyhlhvhftalgfrahllaevienlecdprhyqqrtmtfalraddpllkllqe aqq
Timeline for d1xmla1: