Lineage for d1xmla1 (1xml A:146-336)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157268Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 protein domains)
  6. 2157284Protein automated matches [254454] (1 species)
    not a true protein
  7. 2157285Species Human (Homo sapiens) [TaxId:9606] [254968] (4 PDB entries)
  8. 2157286Domain d1xmla1: 1xml A:146-336 [122166]
    Other proteins in same PDB: d1xmla2, d1xmlb2
    automated match to d1st0a1
    complexed with po4

Details for d1xmla1

PDB Entry: 1xml (more details), 2 Å

PDB Description: Structure of human Dcps
PDB Compounds: (A:) heat shock-like protein 1

SCOPe Domain Sequences for d1xmla1:

Sequence, based on SEQRES records: (download)

>d1xmla1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
mkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtmtfalradd
pllkllqeaqq

Sequence, based on observed residues (ATOM records): (download)

>d1xmla1 d.13.1.3 (A:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
mkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfrahllaevienlecdprhyqqrtmtfalraddpllkllqe
aqq

SCOPe Domain Coordinates for d1xmla1:

Click to download the PDB-style file with coordinates for d1xmla1.
(The format of our PDB-style files is described here.)

Timeline for d1xmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xmla2