PDB entry 1xml

View 1xml on RCSB PDB site
Description: Structure of human Dcps
Class: chaperone
Keywords: scavenger Decapping Enzyme, CHAPERONE
Deposited on 2004-10-04, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216
      • engineered (210)
      • engineered (321)
    Domains in SCOPe 2.07: d1xmla1, d1xmla2
  • Chain 'B':
    Compound: heat shock-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAL77216
      • engineered (210)
      • engineered (321)
    Domains in SCOPe 2.07: d1xmlb1, d1xmlb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xmlA (A:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdmkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtmtfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmlA (A:)
    apvrlpfsgfrlqkvlresardkiiflhgkvneedavvilektpfqveqvaqlltgspel
    qlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlp
    hlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdmkwnqqqlddlyliaichr
    rgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalg
    frahllaevienlecdprhyqqrtmtfalraddpllkllqeaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xmlB (B:)
    gplgsmadaapqlgkrkreldveeahaasteekeagvgngtcapvrlpfsgfrlqkvlre
    sardkiiflhgkvneasgdgdgedavvilektpfqveqvaqlltgspelqlqfsndiyst
    yhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphlesqslsiqw
    vynildkkaeadrivfenpdpsdgfvlipdmkwnqqqlddlyliaichrrgirslrdltp
    ehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfeapgsgvera
    hllaevienlecdprhyqqrtmtfalraddpllkllqeaqqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xmlB (B:)
    vrlpfsgfrlqkvlresardkiiflhgkvnedavvilektpfqveqvaqlltgspelqlq
    fsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlphle
    sqslsiqwvynildkkaeadrivfenpdpsdgfvlipdmkwnqqqlddlyliaichrrgi
    rslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgfer
    ahllaevienlecdprhyqqrtmtfalraddpllkllqeaqq