Lineage for d1xltg2 (1xlt G:1-143,G:327-378)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857723Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2857729Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 2857730Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 2857767Domain d1xltg2: 1xlt G:1-143,G:327-378 [122133]
    Other proteins in same PDB: d1xlta1, d1xltb1, d1xltc2, d1xltc3, d1xltd1, d1xlte1, d1xltf2, d1xltf3, d1xltg1, d1xlth1, d1xlti2, d1xlti3
    automatically matched to d1f8ga2
    complexed with na, nad, ndp

Details for d1xltg2

PDB Entry: 1xlt (more details), 3.1 Å

PDB Description: crystal structure of transhydrogenase [(domain i)2:domain iii] heterotrimer complex
PDB Compounds: (G:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d1xltg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xltg2 c.23.12.2 (G:1-143,G:327-378) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpa

SCOPe Domain Coordinates for d1xltg2:

Click to download the PDB-style file with coordinates for d1xltg2.
(The format of our PDB-style files is described here.)

Timeline for d1xltg2: