PDB entry 1xlt

View 1xlt on RCSB PDB site
Description: Crystal structure of Transhydrogenase [(domain I)2:domain III] heterotrimer complex
Class: oxidoreductase
Keywords: Transhydrogenase, NAD, NADH, NADP, NADPH, oxidoreductase
Deposited on 2004-09-30, released 2005-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.232
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xlta1, d1xlta2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xltb1, d1xltb2
  • Chain 'C':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (3-173)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1xltc2, d1xltc3
  • Chain 'D':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xltd1, d1xltd2
  • Chain 'E':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xlte1, d1xlte2
  • Chain 'F':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (3-173)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d1xltf2, d1xltf3
  • Chain 'G':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xltg1, d1xltg2
  • Chain 'H':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xlth1, d1xlth2
  • Chain 'I':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59765 (3-173)
      • cloning artifact (1-2)
    Domains in SCOPe 2.06: d1xlti2, d1xlti3
  • Heterogens: SUC, NA, NAD, NDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xltA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddefrkkqaeavlkelvkt
    diaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkiv
    ghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpa
    ltg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xltB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitefrkkqaeavlkelvktdia
    ittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivght
    nvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpalt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xltC (C:)
    rhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xltD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltD (D:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xltE (E:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltE (E:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitveefrkkqaeavlkelvktd
    iaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivg
    htnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xltF (F:)
    rhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltF (F:)
    hmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagr
    mpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmp
    ildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xltG (G:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltG (G:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvdgeefrkkqaeavlkelvk
    tdiaittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvki
    vghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhp
    altg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xltH (H:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltH (H:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfiteefrkkqaeavlkelvktdi
    aittalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivgh
    tnvpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xltI (I:)
    rhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xltI (I:)
    hmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagr
    mpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmp
    ildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn