Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) |
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins) |
Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species) |
Species Thermus thermophilus [TaxId:274] [82555] (3 PDB entries) Uniprot Q7SIC6 |
Domain d1xkvb2: 1xkv B:2-211 [122092] Other proteins in same PDB: d1xkva1, d1xkvb1 automatically matched to d1j3ba2 complexed with atp, ca, gol, po4 |
PDB Entry: 1xkv (more details), 2.2 Å
SCOPe Domain Sequences for d1xkvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xkvb2 c.109.1.1 (B:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr rlvlivgtkyageikksiftvmnylmpkrg
Timeline for d1xkvb2: