Class a: All alpha proteins [46456] (284 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (11 species) |
Species Cow (Bos taurus) [TaxId:9913] [47518] (26 PDB entries) Uniprot P62157 |
Domain d1xfup1: 1xfu P:3-75 [121938] automatically matched to d1ak8__ complexed with ca, mg; mutant |
PDB Entry: 1xfu (more details), 3.35 Å
SCOPe Domain Sequences for d1xfup1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xfup1 a.39.1.5 (P:3-75) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt idfpefltmmark
Timeline for d1xfup1: