SCOPe 2.01: Domain d1xfna1: 1xfn A:26-125

Lineage for d1xfna1 (1xfn A:26-125)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (47 PDB entries)
   Uniprot P16113

8. Domain d1xfna1: 1xfn A:26-125 [121934]
   automatically matched to d1odva_
   complexed with hc4

Details for d1xfna1

PDB Entry: 1xfn

PDB Description: nmr structure of the ground state of the photoactive yellow protein lacking the n-terminal part

PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d1xfna1:

Sequence; same for both SEQRES and ATOM records:

>d1xfna1 d.110.3.1 (A:26-125) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
lafgaiqldgdgnilqynaaegditgrdpkqvigknffkdvapctdspefygkfkegvas
gnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvkrv

Timeline for d1xfna1:

• d1xfna1 first appeared in SCOP 1.73
  
• d1xfna1 appears in SCOP 1.75
  
• d1xfna1 appears in SCOPe 2.02
  
• d1xfna1 appears in the current release, SCOPe 2.08, called d1xfna_