Lineage for d1xfbf1 (1xfb F:3-344)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684106Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)
  7. 684112Species Human (Homo sapiens), brain isozyme [TaxId:9606] [141834] (1 PDB entry)
  8. 684118Domain d1xfbf1: 1xfb F:3-344 [121927]
    automatically matched to 1XFB A:3-344

Details for d1xfbf1

PDB Entry: 1xfb (more details), 3 Å

PDB Description: Human Brain Fructose 1,6-(bis)phosphate Aldolase (C isozyme)
PDB Compounds: (F:) Aldolase C

SCOP Domain Sequences for d1xfbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfbf1 c.1.10.1 (F:3-344) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), brain isozyme [TaxId: 9606]}
hsypalsaeqkkelsdialrivapgkgilaadesvgsmakrlsqigventeenrrlyrqv
lfsaddrvkkciggviffhetlyqkddngvpfvrtiqdkgivvgikvdkgvvplagtdge
tttqgldglsercaqykkdgadfakwrcvlkisertpsalailenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhvylegtllkpnmvtpghacpi
kytpeeiamatvtalrrtvppavpgvtflsggqseeeasfnlnainrcplprpwaltfsy
gralqasalnawrgqrdnagaateefikraevnglaaqgkye

SCOP Domain Coordinates for d1xfbf1:

Click to download the PDB-style file with coordinates for d1xfbf1.
(The format of our PDB-style files is described here.)

Timeline for d1xfbf1: