Lineage for d1xbva_ (1xbv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826772Protein 3-keto-L-gulonate 6-phosphate decarboxylase [75050] (2 species)
  7. 2826773Species Escherichia coli [TaxId:562] [75051] (14 PDB entries)
    Uniprot P39304
  8. 2826778Domain d1xbva_: 1xbv A: [121842]
    automated match to d1kv8b_
    complexed with 5rp, mg

Details for d1xbva_

PDB Entry: 1xbv (more details), 1.66 Å

PDB Description: Crystal structure of 3-keto-L-gulonate 6-phosphate decarboxylase with bound D-ribulose 5-phosphate
PDB Compounds: (A:) 3-Keto-L-Gulonate 6-Phosphate Decarboxylase

SCOPe Domain Sequences for d1xbva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbva_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]}
lpmlqvaldnqtmdsayettrliaeevdiievgtilcvgegvravrdlkalyphkivlad
akiadagkilsrmcfeanadwvtviccadintakgaldvakefngdvqieltgywtweqa
qqwrdagigqvvyhrsrdaqaagvawgeaditaikrlsdmgfkvtvtgglaledlplfkg
ipihvfiagrsirdaaspveaarqfkrsiaelw

SCOPe Domain Coordinates for d1xbva_:

Click to download the PDB-style file with coordinates for d1xbva_.
(The format of our PDB-style files is described here.)

Timeline for d1xbva_: