![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
![]() | Protein butyrate kinase 2 [142460] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries) Uniprot Q9X278 1-172! Uniprot Q9X278 173-375 |
![]() | Domain d1x9je2: 1x9j E:173-371 [121820] automatically matched to 1SAZ A:173-375 complexed with cit, gol, na, po4 |
PDB Entry: 1x9j (more details), 3 Å
SCOPe Domain Sequences for d1x9je2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9je2 c.55.1.2 (E:173-371) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp knyseesrrwrerydsyld
Timeline for d1x9je2: