Lineage for d1x9je2 (1x9j E:173-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884165Family c.55.1.2: Acetokinase-like [53080] (4 proteins)
  6. 2884180Protein butyrate kinase 2 [142460] (1 species)
  7. 2884181Species Thermotoga maritima [TaxId:2336] [142461] (2 PDB entries)
    Uniprot Q9X278 1-172! Uniprot Q9X278 173-375
  8. 2884193Domain d1x9je2: 1x9j E:173-371 [121820]
    automated match to d1saza2
    complexed with cit, gol, na, po4

Details for d1x9je2

PDB Entry: 1x9j (more details), 3 Å

PDB Description: Structure of butyrate kinase 2 reveals both open- and citrate-induced closed conformations: implications for substrate-induced fit conformational changes
PDB Compounds: (E:) Probable butyrate kinase 2

SCOPe Domain Sequences for d1x9je2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9je2 c.55.1.2 (E:173-371) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]}
yeemnlvvahmgggisiaahrkgrvidvnnaldgdgpftpersgtlpltqlvdlcfsgkf
tyeemkkrivgngglvaylgtsdarevvrrikqgdewakrvyramayqiakwigkmaavl
kgevdfivltgglahekeflvpwitkrvsfiapvlvfpgsneekalalsalrvlrgeekp
knyseesrrwrerydsyld

SCOPe Domain Coordinates for d1x9je2:

Click to download the PDB-style file with coordinates for d1x9je2.
(The format of our PDB-style files is described here.)

Timeline for d1x9je2: